PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_2285g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 146aa    MW: 15636.5 Da    PI: 8.4968
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_2285g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.73.1e-2988144360
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                   +vrY +C+kNhAas+Gg+avDGC Efm+s g++gtaa+++CaAC+CHR+FHR e e+e
  MA_2285g0010  88 GVRYGDCRKNHAASIGGYAVDGCAEFMAS-GNKGTAAGMNCAACNCHRSFHRNEIENE 144
                   79**************************9.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047709.3E-2789141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2089146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.2E-2490141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.41391140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MPITSTRSLS VSNSTGLQRY RQVKDLATDK FGSVFLHLRK EVPGTRSIQI QPQSIASADQ  60
MGPSKIVQQI EAGSAATAKD EDIASRNGVR YGDCRKNHAA SIGGYAVDGC AEFMASGNKG  120
TAAGMNCAAC NCHRSFHRNE IENETL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1062231e-148BT106223.1 Picea glauca clone GQ02905_E14 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922896.19e-28PREDICTED: mini zinc finger protein 1-like
TrEMBLA9NSF76e-69A9NSF7_PICSI; Putative uncharacterized protein
STRINGSi027403m2e-24(Setaria italica)
STRINGPOPTR_0004s12510.14e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-27mini zinc finger 2